PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0025s0018.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 293aa    MW: 32605.8 Da    PI: 7.2673
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0025s0018.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.69.5e-32215273159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vk+s +prsYYrCt+ gC+vkk+ver +ed ++v++tYeg+H h+
  Kalax.0025s0018.1.p 215 LDDGYKWRKYGQKVVKNSLHPRSYYRCTQMGCRVKKRVERLSEDCRMVITTYEGRHSHP 273
                          59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.2E-34200275IPR003657WRKY domain
SuperFamilySSF1182904.97E-29207275IPR003657WRKY domain
PROSITE profilePS5081131.514210275IPR003657WRKY domain
SMARTSM007742.5E-37215274IPR003657WRKY domain
PfamPF031069.2E-25216273IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEGGGGGRSE FVFGSRDDDQ QGSIFSTHPR QMELHHNSDD FLAASSSSAP AAANNRHVFT  60
LLSHHPNSSS TSTPATACVA AAGSSTMAMG FINCHNEEEE KDDDQHLFAA HDNRLLNAWK  120
TVYHQQHGLR STILDPREAD GVGNNEEDYH GDDTQTTKIS HSWWRRCPAS SSSEKITSKA  180
ASGKISGSST GVVKMRRKLR EPRFCFQTRT DIDVLDDGYK WRKYGQKVVK NSLHPRSYYR  240
CTQMGCRVKK RVERLSEDCR MVITTYEGRH SHPPPPPDDA NSSDHDPCFS SF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-25206275877Probable WRKY transcription factor 4
1wj2_A2e-25206275877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ93WY46e-58WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A151QW852e-58A0A151QW85_CAJCA; Putative WRKY transcription factor 12
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-49WRKY family protein